Titre:isparta escort | isparta gerçek escort bayan | isparta eskort
Server:cloudflare...
L'adresse IP principale: 91.134.145.113,Votre serveur Bulgaria,Sofia ISP:Etropol Cabel Company Ltd. TLD:com Code postal:bg
Ce rapport est mis à jour en 25-Jul-2018
Created Date: | 2018-01-06 |
Changed Date: | 2018-01-13 |
Geo IP vous fournit comme la latitude, la longitude et l'ISP (Internet Service Provider) etc. informations. Notre service GeoIP a trouvé l'hôte ispartavize.com.Actuellement, hébergé dans Bulgaria et son fournisseur de services est Etropol Cabel Company Ltd. .
Latitude: | 42.697509765625 |
Longitude: | 23.324150085449 |
Pays: | Bulgaria (bg) |
Ville: | Sofia |
Région: | Grad Sofiya |
ISP: | Etropol Cabel Company Ltd. |
domaine | Titre |
---|---|
ispartavize.com | isparta escort | isparta gerçek escort bayan | isparta eskort |
sanliurfaemlak.info | Şanlıurfa escort | urfa gerçek escort bayan |
kahramanmarasevdenevenakliyat.info | kahranmaraş escort | maraş gerçek escort bayan |
vannakliyatambari.info | van escort van gerçek escort bayan |
bayburtkarate.com | bayburt gerçek escort |
yalovahotel.info | yalova escort -yalova gerçek escort bayan |
sivasgazetesi.info | sivas escort - sivas gerçek escort bayan |
didimdekiralikyazlik.info | didim escort | didim gerçek escort bayan |
afyonisrehberi.net | afyon escort | afyon gerçek escort bayan |
bergamaescortbayan.xyz | bergama escort | bergama gerçek escort bayan - |
malatyagazetesi.info | malatya escort | malatya gerçek escort | malatya escort bayan - |
samsunsev.com | samsun escort | samsun gerçek escort bayan | samsun eskort |
kariyerduzce.com | düzce escort | düzce gerçek escort bayan | düzce eskort |
mymusak.com | uşak escort | uşak gerçek escort bayan | uşak eskort |
gebzeyemek.info | gebze escort | gebze gerçek escort bayan | gebze eskort |
Les informations d'en-tête HTTP font partie du protocole HTTP que le navigateur d'un utilisateur envoie à appelé cloudflare contenant les détails de ce que le navigateur veut et acceptera de nouveau du serveur Web.
Content-Encoding: | gzip |
Transfer-Encoding: | chunked |
Set-Cookie: | __cfduid=de260ffb1a892553c5bf7bad15c3ef8fc1532465544; expires=Wed, 24-Jul-19 20:52:24 GMT; path=/; domain=.ispartavize.com; HttpOnly |
Server: | cloudflare |
Last-Modified: | Thu, 30 Jun 2016 14:48:05 GMT |
Connection: | keep-alive |
Date: | Tue, 24 Jul 2018 20:52:24 GMT |
CF-RAY: | 43f94535352a91dc-EWR |
Content-Type: | text/html |
soa: | evan.ns.cloudflare.com. dns.cloudflare.com. 2028105946 10000 2400 604800 3600 |
txt: | "v=spf1 +a +mx +ip4:91.134.145.113 ~all" |
ns: | evan.ns.cloudflare.com. ulla.ns.cloudflare.com. |
ipv4: | IP:91.134.145.113 ASN:16276 OWNER:OVH, FR Country:FR |
mx: | MX preference = 0, mail exchanger = ispartavize.com. |
Whois est un protocole qui permet d'accéder aux informations d'enregistrement.Vous pouvez atteindre quand le site Web a été enregistré, quand il va expirer, quelles sont les coordonnées du site avec les informations suivantes. En un mot, il comprend ces informations;
Domain Name: ISPARTAVIZE.COM
Registry Domain ID: 2209401189_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-01-13T11:37:45Z
Creation Date: 2018-01-06T15:26:43Z
Registry Expiry Date: 2019-01-06T15:26:43Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: EVAN.NS.CLOUDFLARE.COM
Name Server: ULLA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-03-25T18:49:49Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
REGISTRAR GoDaddy.com, LLC
SERVERS
SERVER com.whois-servers.net
ARGS domain =ispartavize.com
PORT 43
TYPE domain
RegrInfo
DOMAIN
NAME ispartavize.com
CHANGED 2018-01-13
CREATED 2018-01-06
STATUS
clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
clientRenewProhibited https://icann.org/epp#clientRenewProhibited
clientTransferProhibited https://icann.org/epp#clientTransferProhibited
clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
NSERVER
EVAN.NS.CLOUDFLARE.COM 173.245.59.165
ULLA.NS.CLOUDFLARE.COM 173.245.58.233
REGISTERED yes
La liste suivante vous montre les fautes d'orthographe possibles des internautes pour le site Web recherché.